DPCstruct | MC30138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 33.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091AYF4 | 147-205 | PLDQVVIALSRSGCYGTCPIYQVEIHGDGRVVYQGDDFVDVRGTHAYRVPVEEVRRLVD |
| A0A6I0F5V7 | 5-65 | IRLERTMCYGTCPVYNVTVNKDGKVKYEGEMYVYRIGKHQWKISNKKVKQLSDLFVILLHF |
| L0HQI6 | 11-72 | None |
| A0A2U9TL24 | 148-201 | None |
| A0A514C3A5 | 130-187 | None |
| A0A146H4R9 | 265-328 | None |
| A0A2G2KAS2 | 21-81 | None |
| A0A2V9T5A0 | 23-87 | None |
| A0A418WI70 | 153-213 | None |
| N8W488 | 29-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.