DPCstruct | MC30135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 104 ± 17 aa |
| Standard deviation of domain lengths | 17.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7M052 | 14-104 | VSMGAHAARKAGEIAFNARRVVATEILAACQAIDLREGEGFKLGAGTQAAYDAVRKSNDFIAYDKDIEMFKELEKITNLVQEGGILD… |
| A0A7V5NUY0 | 189-297 | RILCAPASVQSIPAAADQEDFVSMGMNTAIKNFQIMDNAYGILGIEFMAAAQALDFREEEYKFGAGVTKAKEIIRKYVDFLDIDRPL… |
| A0A380F9U0 | 1-78 | None |
| A0A444UL10 | 464-593 | None |
| A0A538THW5 | 1000-1109 | None |
| A0A380DNF3 | 128-236 | None |
| A0A6A3XUQ0 | 231-316 | None |
| A0A6A3YC49 | 84-168 | None |
| X0XV72 | 2-82 | None |
| A0A0B1S6W4 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.