DPCstruct | MC30132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 95 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0292- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5JGP0 | 2-83 | PFAAGSATDQLARALGQAVTTATKQAVVVENKGGASGMIAAQQVARSAADGYTVLITTNTTHAANQHLYKKLPYDAVKDFAP |
| A0A0P0MEE1 | 3-104 | IPLIRQLILLCLLGLLPFGSFAQEWPAKPIRIVVPYPAGGGVDAAARLVAQHLTTVLGQSTVIDPKPGGGTVIGADMVARAAPDGYT… |
| A0A4Q3N1W1 | 10-113 | None |
| A0A0Q4Y1P8 | 31-120 | None |
| A0A171JZJ4 | 11-107 | None |
| A0A0M4KPF2 | 21-109 | None |
| A0A2V7XV63 | 15-125 | None |
| A0A536W722 | 430-521 | None |
| A0A4Q5WI43 | 10-93 | None |
| A0A1I3UFT3 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.