DPCstruct | MC30131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 410 ± 39 aa |
| Standard deviation of domain lengths | 38.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2HFC1 | 1-495 | GRPGGDMLFYVYFQLLVIPFQIVADIFLHGCLELFYGWKLYDYLVYTRYRFLQRETRWKGMEASLDESMSETFRTLDQMCFSSQYYM… |
| A0A7S3NIH4 | 768-1119 | DMFYYLLFALIIIPFQFVADVFTLSVLELYHGWRIYDYIIYTRYRFLQRETRWKGLEDSLDECIDESVRTLDQMCFSSQYYMMLTIH… |
| A0A6A3UDS3 | 832-1229 | None |
| A0A833WL43 | 130-570 | None |
| A0A067BUD6 | 219-618 | None |
| A0A6G0XC20 | 3-461 | None |
| A0A812MF39 | 223-629 | None |
| A0A3F2S521 | 822-1218 | None |
| A0A7S2HFA4 | 656-1057 | None |
| A0A2P4Y6Z2 | 533-927 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.