DPCstruct | MC30130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2Z272 | 207-308 | DTEGEFLDEEISKLRTDVTDKGLGLLVIGEWYNRAQMNKLAFFDDNTRSIWHPIVGGSNVPALNRLLDGLGIAFSDEVTKGDLRLGR… |
| A0A7S2H5H7 | 1-141 | DPEEEFFAEEVLKLERDVRETRLSVIVLADWYSSEALDEVQFFDDNTRSTWVAVTGGSNIPALNDLLAPFDIALSGKIFHGQWKVGK… |
| A0A444EQ09 | 183-300 | None |
| A0A4Z2CQU5 | 368-492 | None |
| A0A7J7LTP9 | 167-318 | None |
| A0A0D2MTR6 | 703-822 | None |
| A0A7M5XJI2 | 319-437 | None |
| V9E1C5 | 507-627 | None |
| T1GUD9 | 106-220 | None |
| R1DDY7 | 671-808 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.