DPCstruct | MC30129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 231 ± 46 aa |
| Standard deviation of domain lengths | 46.32 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.94 |
| Pfam Score | 89.34 |
| Assigned Pfam label(s) | PF12230- PF09750- PF01805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2H3T7 | 6-255 | PPPDSNMMVPASPKIGRLIAATALKARRSPQVEILVKVHQAGNSMFGFLDCDHPLQGYYLYLRSEVPVAALEEFVVSSTSKQHTEAA… |
| A0A642UC73 | 1-241 | MAPPSPIRRSIEKTAEYVVKNGPEFEEKIRKNNTDHKFDFLLADDEWHPYYLEVLEAAKQDSKPSSDSGAKPEIKQAPPELHFITPL… |
| A0A364N1T2 | 18-255 | None |
| A0A402FJH3 | 154-365 | None |
| A0A3Q0KK75 | 17-250 | None |
| A0A1G4MGV4 | 1-276 | None |
| A0A1Y1W5E9 | 165-406 | None |
| A0A1Y1WKL6 | 3-206 | None |
| A0A1V8SN43 | 18-253 | None |
| A0A3M9YKF0 | 485-731 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.