DPCstruct | MC30123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2F1W3 | 1-112 | QGVTRALDPLLLPLLDEAVRLQTLQDQAISNGDLPEALRLRAATSSRGVLMQELEYARRDDDDEAAEAIARELEFASALRADVTQDE… |
| L1JGK2 | 288-397 | KATKEELEDLVLPGMDEVERRIVMIQRAVEREDYGTASQLAANQSRRGRIAAAIVEAVREERYYEAAELQEELEVITMGRADITQDE… |
| A0A7S2CV32 | 201-309 | None |
| A0A7S0VNU8 | 1-103 | None |
| A0A7R9U4Z2 | 126-228 | None |
| A0A0M0JD67 | 158-276 | None |
| A0A7S4L3H0 | 132-241 | None |
| A0A7S2ZRW8 | 80-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.