DPCstruct | MC30118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 963 |
|---|---|
| Mean domain length (aa) | 168 ± 38 aa |
| Standard deviation of domain lengths | 38.20 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.62 |
| Pfam Score | 98.70 |
| Assigned Pfam label(s) | PF00829- PF12548- CL0533- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4USW5 | 52-214 | SDHGDGMASHRMVTKHISFYDEMTNVPFIFAGPGIKKQKKPINHLLTQPTIDLLPTLCDLAGIEVPADKIGISLAPTLKGEKQVQTH… |
| A0A7W0X3J6 | 22-166 | EEGIRSPFVVRYPKRVKSGSRRKELVICQDIAPTLIQLAGGRPGAQIQGRSLLPLFAGGRAGWRKSILCEYWAEQALPWLVGMTYKA… |
| A0A5B7DD06 | 274-453 | None |
| A0A3D3LFF5 | 8-145 | None |
| A0A3D3LEY6 | 33-207 | None |
| C3ZV84 | 589-762 | None |
| A0A1P8WNU5 | 1-116 | None |
| A0A7R9L4Q8 | 68-289 | None |
| A0A520QSJ6 | 321-464 | None |
| A0A7C5J2C7 | 35-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.