DPCstruct | MC30114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 99 ± 16 aa |
| Standard deviation of domain lengths | 15.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.54 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF09876- CL0347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8HB30 | 1-77 | MDGLIPWLKALAHESGIQTITPAVISRVRGRSPDLQLRVSTPIHGGYKLVARKGSSAQEVFVVTSMSQPDLEQALQH |
| A0A831KT42 | 39-142 | LKKVNLRPEDKIQGSHSTIIGEREGYQLLLRIATSPYVKKIVLGIIESSGTRSYGGLRFKVTRCDERGNIKGLLIHGSTVQQIYLIT… |
| A0A6S7NGW4 | 664-757 | None |
| F0T0W2 | 4-87 | None |
| A0A835HJ89 | 106-201 | None |
| A0A7C3G9C5 | 1-123 | None |
| A0A0Q9YBD3 | 4-89 | None |
| A0A358I3B2 | 44-127 | None |
| A0A7C6RYV4 | 5-109 | None |
| A0A2D4SRK9 | 17-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.