DPCstruct | MC30112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 499 ± 73 aa |
| Standard deviation of domain lengths | 72.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5VBX7 | 19-427 | EAALAHRRQFPPEEWGYHYYLSCAAAAPEHQADLAVAVKLMVASSSLQPIVERCTPQHVTPTLLHIDLRDLQWNPGDWKQVLADYPY… |
| A0A5C7MB88 | 44-529 | PVVGPPPVADAFGGKAVSGKPPFGTPQEEVFTAAKWVKSLLEAKDGNPRVGKLVVGPEGVKDLLKHIRFLSVYHLPPTEREDYTKGL… |
| A0A5C1AH25 | 13-481 | None |
| A0A6L8ETN0 | 31-554 | None |
| A0A495Z9E6 | 40-550 | None |
| A0A1I2HZ10 | 67-607 | None |
| A0A517QMS8 | 33-608 | None |
| A0A7X3VLE1 | 9-365 | None |
| A0A7V9L1R0 | 68-545 | None |
| A0A7C4V5D9 | 138-768 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.