DPCstruct | MC30108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 239 ± 43 aa |
| Standard deviation of domain lengths | 43.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178AXU9 | 231-453 | HVREDCDAPPVSSARKRTRSKAQGMSKSSAMSDKKPCIGREVDEDDEEATVVTETSRTFLISDMEGLEKFLRHRLTELTMKPVRGMV… |
| A0A167V8M4 | 16-250 | QPEPPFQPAMWPSRESWPLQAGSQAEMNFGGRTLNLASHQRVLISIKDRCLLRRYYEKIFQTLQQTNCRIIAKAYIKLVEPRKQVNY… |
| A0A1Q5UBD4 | 1-199 | None |
| W2RVG4 | 46-335 | None |
| A0A1G4MK29 | 72-298 | None |
| Q5AVF3 | 211-477 | None |
| A0A4U0Y232 | 73-320 | None |
| A0A6G1IG39 | 14-347 | None |
| A0A5N6E6S9 | 138-345 | None |
| R1H041 | 56-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.