DPCstruct | MC30102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 7.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7UYU4 | 2-90 | AGAQPGVHALQLEPVRVSESLKKGSKFMKWDDDASTVTPVTLRVDPQGYFLYWTDQSKETEILDITYIKDARTGKCTKTPKVPTVLI… |
| A0A151MGW2 | 1-83 | MAGAQPGVHALQLQPVRVSDGLKKGTKFVKWDDDSTVVTPIILKTDPQGFFFYWTDQNKETELLDTSLVKDARCGKHARAPKC |
| A7RXP5 | 1-80 | None |
| A0A3Q3FPS7 | 1-73 | None |
| A0A267GDJ3 | 1-83 | None |
| A0A183H3A5 | 1-76 | None |
| A0A812DU12 | 1-78 | None |
| A0A3Q2T4S5 | 1-65 | None |
| A0A094ZQ13 | 5-96 | None |
| A0A7J7JPZ2 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.