DPCstruct | MC301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 19.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.38 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF11946- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9XY80 | 20-138 | LGVQETRELFSKAFADGNRKRWRLNHSPLFLDFLEGKVDFPCTAWAIPSYSLFGWQRPCYLMSDGYTQTYQELLDETDWESYGRGRD… |
| A0A7C1KPE3 | 3-109 | FIYELSKKYKIMNTPIYLKFLKGERDLMCTPWGNPTRNYLGWKGPCYLITDAYFETFKEFMDTTDWDRYGTGKDPRCRNCMMHCGFE… |
| H6RL59 | 413-551 | None |
| A0A7V8AJY2 | 56-187 | None |
| A0A7X9KSU7 | 519-654 | None |
| A0A7Z9S2R5 | 32-163 | None |
| A0A7C5CYN5 | 236-384 | None |
| A0A538M5W1 | 194-317 | None |
| A0A7V8VDQ5 | 884-1041 | None |
| A0A7V0KJP2 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.