DPCstruct | MC30098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 199 ± 31 aa |
| Standard deviation of domain lengths | 30.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9FY44 | 4-198 | ESYGVWKAKPVRYTYEDSHQDSVSPHLFLFFTDDEAEEGQAAINIKSGDHAESRLAYWTVPHFTHPITEKLDALNDSFQLLAGTSEQ… |
| A0A2W5YQH4 | 2-169 | AGKPLGFGAEIDRVPANIDHFWITLGTKTGDPIRVALSTHSRQNAAAGFDPRIRLGTVASAWTDLPPSALVKSSGLDYREIEAVSPV… |
| A0A853QYX3 | 1-162 | None |
| A0A521UKL8 | 1-152 | None |
| A0A356T6H6 | 8-164 | None |
| A0A1S1XXQ2 | 1-217 | None |
| Q5AT31 | 3-249 | None |
| A0A229XPV7 | 96-319 | None |
| A0A261DD49 | 2-215 | None |
| A0A521UKV4 | 1-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.