DPCstruct | MC30094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 19.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3HQ85 | 43-179 | MRGDEGYLLALAYSTQRGYGRNHPFAGEIRSGYIDVSIVPEELGFAVNVGELLMTECEMVNGFIDPPDEPPHFTRGYGLVFGMSERK… |
| T3D751 | 8-131 | KIYSMIKNISSISIIKEPNLATVMVRANESVNNATFNLGEILVTECSVKVDESLGYGIVAENDDKKVVYLAAIDAVLHSNNTKFDEL… |
| A0A3M3P0P6 | 151-302 | None |
| A0A846N242 | 6-122 | None |
| A0A376X6C5 | 392-527 | None |
| A0A2A3VTK0 | 181-301 | None |
| A0A0N8KLX8 | 209-363 | None |
| W1F1E3 | 6-153 | None |
| A0A2M8PFA7 | 11-123 | None |
| A0A1S6RZR8 | 16-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.