DPCstruct | MC30091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 235 ± 21 aa |
| Standard deviation of domain lengths | 20.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A246TVZ1 | 9-253 | AILSWQIIVPDFGMVTGPDSSGDVYFNLDPLWSSPAIDAVGIDNYMPRADWRDDDLTNASPDGFRTADDLQAMTTAITSGGGFAWYY… |
| A0A562CPH2 | 316-576 | GLTVLRDGENRFPFVEVLAELAGEVRGVLGQETLITYGADWSEYFGHQPQDGSGDVFFHLDPLWAHDAVDAVGIDNYMPLSDWRDAD… |
| A0A0F3MK30 | 260-474 | None |
| A0A2E7K0J5 | 37-277 | None |
| A0A1B6NQE4 | 211-445 | None |
| A0A7X6BNL8 | 397-605 | None |
| A0A2P7BVT9 | 412-663 | None |
| A0A7U0IZ83 | 423-631 | None |
| E2CNP0 | 444-651 | None |
| A0A0Q6S689 | 446-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.