DPCstruct | MC3009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19460 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0QJS1 | 6-117 | QQQTMKPVTAAKKLGIHLPAAPSEFRDAPSISRSELGRLMSTPPAWLTALREHGPHPRDVVASRLGVSIAGLTRGGLTEPLTTEEIT… |
| A0A3N7HYD2 | 1-108 | MQYLSAQTAAKKLGIYLPAAPAEFRENQHSRDELAALQTDPPAWLRTLRAEGPHPRSEVSRRLGITNSGLARAGVADAMTTAEIQAI… |
| A0A2S8CKF1 | 16-133 | None |
| A0A170RUG9 | 110-219 | None |
| C3PFC3 | 164-282 | None |
| A0A7W4CVL2 | 1-116 | None |
| A0A1W1U9K6 | 244-355 | None |
| A0A2W5RH79 | 11-120 | None |
| A0A653EWG9 | 6-119 | None |
| A0A4Q7LV20 | 13-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.