DPCstruct | MC30087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 138 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 61.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444E9H2 | 1-143 | MMEAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFGLLQEFYETTLKALEEAKNERLWFKTNLKLCTIWFDIGEYGRMSKIL… |
| A0A016WE95 | 86-221 | LQYYQKLLKYIKTAVTKNYSEKSINAILDYISTSKQMDLLQKFYETTLDALKDAKNERLWFKTNTKLGKLYFDMREFQKLEKILKQL… |
| A0A4S4M3G1 | 135-276 | None |
| A0A2N9G435 | 1-138 | None |
| A0A7R8XFK1 | 93-228 | None |
| B0XKN1 | 234-354 | None |
| A0A183BQE5 | 85-220 | None |
| A0A1I7XQC4 | 373-521 | None |
| A0A364LAI7 | 74-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.