DPCstruct | MC30085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 53 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804IQA2 | 1-61 | MPRLIIDFLISLDDRYLYFLNWFHGDVRQYNIEDPLKPVLTGQVWVGGLRLCGKGWGGVTI |
| A0A835MJJ3 | 562-616 | MPGLITDFLISLDDRFLYFSNWLHGDVRQYNIEDPKNPVLKGQVWVGGLIQRGSP |
| A0A426YVA8 | 134-188 | None |
| A0A6V7QY21 | 659-713 | None |
| G0PAH8 | 127-177 | None |
| A0A0M3JPY8 | 14-62 | None |
| A0A402G227 | 84-127 | None |
| A0A2G9UMF6 | 56-116 | None |
| A0A2G9U6B4 | 1-48 | None |
| X7YSN8 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.