DPCstruct | MC30080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9Q6Y2 | 88-158 | VRPVFNSVRYGDADYSQLSTHCAIEIKEGADDGAEMGAFHDLYQPQRVANLRARLDEYLRFGLEAGIFFAS |
| A0A6P0QN16 | 1-85 | MQPHFTSERYGEPTYAQLNTICPIEIRTGTEDGSEMGVFNFLKQPQREANLQASLKEYLRFGLQADILYSPYLLSGTKDESKLAQ |
| A0A7K2NTS9 | 172-253 | None |
| A0A846CF06 | 11-79 | None |
| A0A2V3VED4 | 220-290 | None |
| A0A0B0EN54 | 341-411 | None |
| A0A4D4N993 | 131-203 | None |
| A0A399ECF5 | 512-582 | None |
| A0A2P5MQW2 | 51-121 | None |
| A0A7C4J7T5 | 264-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.