DPCstruct | MC3008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Standard deviation of domain lengths | 24.42 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.00 |
| Pfam Score | 70.87 |
| Assigned Pfam label(s) | CL0105- PF13376- CL0631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A193BXP4 | 1-86 | MDKRFTATLLKSPEKGGWTYVVMPGSAEFFGTKGLVKVRGTIDGQPFRSSFMALGDGTHKLPVKAEVRKAIGKEAGDTVDVVLLER |
| A0A3C1DVR2 | 10-114 | LEFETVIQRADVTGSSAFVAVPVDVLELFGSRGRVPVSATFDGVAYRGSTVSWGGPPLLLVLTSIQRQLGKGPGDSLQVRIESYRAM… |
| A0A2J0JHI0 | 20-131 | None |
| S0K083 | 157-250 | None |
| A0A4Q3JVN8 | 30-161 | None |
| A0A371BUL4 | 42-143 | None |
| A0A7C1HF45 | 10-165 | None |
| A0A534WJB5 | 104-239 | None |
| A0A5R8QD24 | 4-131 | None |
| A0A506Y7P7 | 6-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.