DPCstruct | MC30076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 213 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6RWP1 | 8-215 | DFLLFGYFGCDGNDGADTMRNRAAHRAYLDLARTVNYRLSTSQLAEKLKKRSSEYEKKEAETFIKKKEALVDSVCERLYPLPAGDFD… |
| A0A420W5V5 | 13-244 | NYFQNVDRACRIKKPVPVRLPTGLGVIGICINRAYSGSSVARVCRGIGNNAVYTSGNFREQSVKQIMFNEVARFLIDVCNGSIKSKR… |
| A0A7J4EKV3 | 10-208 | None |
| A0A241TYP8 | 1-158 | None |
| A0A2S8CG17 | 1-209 | None |
| A0A1T4VCY4 | 5-213 | None |
| A0A3R5ZQI0 | 8-236 | None |
| A0A1H7Q7K9 | 1-216 | None |
| A0A3D5LNI7 | 2-243 | None |
| A0A1I4EHZ9 | 4-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.