DPCstruct | MC30072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 385 ± 68 aa |
| Standard deviation of domain lengths | 68.13 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0WS94 | 6-374 | RDWTELARASASRTLVHAHSCCPKCASTGLLQPAFDYVCVGAATALHCALAEYAGMPSSGTAFTSRRPGWPRSLEDLFPGGTDRTLN… |
| A0A165ERV0 | 47-469 | EGDDSLVEVLRTKQHAFWDACVAMLTVPRDPDAVLALRAHLAETARNCWNQKEHRTVERNNPWGSNDPLFVFIEGLCYSLRACLEGG… |
| J0CTM5 | 101-522 | None |
| J0CWC5 | 11-408 | None |
| J0D788 | 5-311 | None |
| J0D8F2 | 109-544 | None |
| J0LEY5 | 21-392 | None |
| J0WS17 | 4-280 | None |
| J0WMD0 | 67-473 | None |
| J0WT04 | 11-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.