DPCstruct | MC30070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 238 |
|---|---|
| Mean domain length (aa) | 222 ± 56 aa |
| Standard deviation of domain lengths | 56.39 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 11.20 |
| Pfam Score | 43.81 |
| Assigned Pfam label(s) | PF19196- PF10927- CL0021- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165BF07 | 51-273 | VLTKTRLVDKNRPFVVVHRTEGSQTPPCEVSIRLQGFLMKPVLRSLGNWDGTSHNAWKAVQSLALAGNDSEPWLVTLAQLNNVIKVV… |
| D6RMT2 | 11-257 | RLVLDSHIARASQEDGQPMLLADADPNSLSVVQFENPSTYRLTQRDDPESETYFKVIGVLCSKVLPPFQTTPKIRTLQHLRNLRQFV… |
| A0A1Q9CAG7 | 5-206 | None |
| A0A4S8MNQ8 | 1-298 | None |
| A0A4S8MLC8 | 2-205 | None |
| A0A2H3D6J8 | 45-258 | None |
| A0A813AHT2 | 104-294 | None |
| A0A417KJR1 | 386-556 | None |
| A0A7C1MNH3 | 8-201 | None |
| A0A2B4SJS5 | 11-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.