DPCstruct | MC3007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 195 ± 54 aa |
| Standard deviation of domain lengths | 53.91 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF02690- PF00194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0X2A1 | 160-343 | ALLKGGIAKQRWNMTDSGAGTFITILSLTSLCCCLFLIVYFLQVIVKGPAARVLRTVVGFNGYLNILIGLGITILVQSSSITTATLT… |
| A0A355SI89 | 164-332 | GLGMLLLGLKLINSGVPFLKSDPYIINFFRVYGNNTIISLIIGTLLTAAVQSSSAVMGVTMILARYDLISLGGAISLMIGSNIGTCA… |
| A0A7S2VPL1 | 100-290 | None |
| A0A812P2Y4 | 173-384 | None |
| A0A067BVN9 | 154-406 | None |
| A0A5N5TLU6 | 53-199 | None |
| A0A820GQ75 | 43-228 | None |
| A0A1D2MY27 | 57-263 | None |
| A0A2E2VBW8 | 2-181 | None |
| A0A831SKL0 | 2-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.