DPCstruct | MC30068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2ESC2 | 1-58 | MREVPGDRALKPYTCPGCNSPIPVGMAHLVAWPEEPGFGFESGLEQRRHWHSHCWRLN |
| A0A2S6IWW3 | 48-128 | RGSPAPVGMQRVESGPDGDWVVRAVTGAASAKTYRCPGCAQSIPAGQAHVVAWPLEGTFSRAAGMEERRHWHGGCWRARGS |
| K6WUA0 | 96-172 | None |
| A0A7K2B9R6 | 5-62 | None |
| E3IXL0 | 19-100 | None |
| A0A212T5Z9 | 24-98 | None |
| A0A366ZYE0 | 19-100 | None |
| A0A849BTH1 | 45-110 | None |
| X8F4N8 | 2-68 | None |
| A0A098BIB5 | 147-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.