DPCstruct | MC30064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 80 ± 1 aa |
| Standard deviation of domain lengths | 0.80 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 93.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4L8Q9 | 96-174 | WKAFTDNLYNHLAARVGRSRTGLRRSLRVSYAKVAEYQKRAAVHVHAVVRLDGARGPDDPPPAWATADVLTAVVRTAAS |
| A0A7W3LXF2 | 195-273 | WRRLTLAVPRKITAELGITHKAFRQQARISYARVIEYQRRGLIHFHAVVRLDGPNGPDEAPPAWATSDLLERALRTAVA |
| A0A4R3IBP0 | 11-89 | None |
| A0A6G8FZP1 | 7-86 | None |
| A0A7K3E9B6 | 63-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.