DPCstruct | MC30063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A543MES1 | 3-86 | LLLDAVEEKFGSRLQFDEDFYWNVPLSDATTLDRDPELNVGSVVDDAASVRELLARAPDDGVFIWHDVDHLVGVLRAIGRLDLP |
| A0A2S6IC56 | 1-134 | MIAPHARHDGALADCWIQIGWHPQAMTGATSVSMTVLRAALDRVLGEVQRRHGDVVDLDADLYYVLPAESVYAPGTVPDGQACTLGS… |
| A0A3N2CTY2 | 2-116 | None |
| A0A839DS47 | 7-98 | None |
| I1D6F2 | 204-297 | None |
| A0A5C8C2X2 | 2-88 | None |
| A0A1M5DXH2 | 5-103 | None |
| A0A2S0N9C5 | 1-119 | None |
| A0A858SS60 | 1-94 | None |
| A0A0M2RE89 | 131-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.