DPCstruct | MC30062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0DR14 | 59-195 | KDLIETCCAAGQQWAIDNDECLEIPENGAEGDVCRTAQRRCCVSYLQEKSCMAGVLGAKEGEACGAEDGSTCSVSLYKQCCDCCGLG… |
| A0A4Y2KVK9 | 26-146 | EPVLTRCCSSGEVWARNHTTCTGPGEAAKLPPQDRLTCLTALYICCVRTHRQIYCENGKNAARTRKQCVIQPDQGGETFKDCCDACT… |
| A0A1I7S3U6 | 3-147 | None |
| E9ISM2 | 2-151 | None |
| A0A7R9PND1 | 1-144 | None |
| A0A643BVT9 | 292-426 | None |
| A0A817MTR2 | 35-156 | None |
| V3ZWA7 | 21-150 | None |
| A0A3B1K3Q0 | 639-775 | None |
| A0A815U5S4 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.