DPCstruct | MC30061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 160 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7UHZ9 | 13-168 | TNLANETNIPTVLREFQTYIRSMDKDFVAATIQAIGRCATNIGRVRDTCLNGLVQLLSNRDELVVAESVVVIKKLLQMQPAQHGEII… |
| U6GCS7 | 17-174 | LDVLVRLASERNLDAVLAELREYAQDVDYEMARRAIRALSSICMRLHGALDRCMQILLDLISRQVPFVVQECAVAFRDIFRKFSGDY… |
| A0A7J5YMT0 | 76-223 | None |
| A0A183TSS9 | 1-151 | None |
| A0A0V0R0I6 | 336-505 | None |
| A0A5D2LAX6 | 312-489 | None |
| C4JZJ4 | 293-452 | None |
| A0A0L0TF75 | 299-460 | None |
| A0A7J6QD83 | 1-156 | None |
| A0A284RWK1 | 64-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.