DPCstruct | MC30059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 219 ± 21 aa |
| Standard deviation of domain lengths | 20.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 81.23 |
| Assigned Pfam label(s) | PF02865- PF01017- CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3NTI8 | 6-219 | TQELQAALTDTSKACHHLWEENKDLQGRFVNELGELQRLQVAIQQLEQNQRAEQAFAAKQSMAEMQKRATTLYELLGQKRSEIVQKL… |
| A0A2Y9H0Z9 | 2-203 | TSPVGSLADTMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGGLAQLSPQERLSRETALQQKQVSLEA… |
| A0A1E1MX08 | 102-334 | None |
| A0A6I8PQY1 | 304-526 | None |
| A0A7R8X7U9 | 45-259 | None |
| A0A4W6FY44 | 112-347 | None |
| A0A3Q1EVF1 | 13-222 | None |
| A0A6P7FHQ8 | 22-227 | None |
| A0A3L7IJM7 | 44-257 | None |
| S9X1S2 | 104-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.