DPCstruct | MC30054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 603 ± 49 aa |
| Standard deviation of domain lengths | 48.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N8RF23 | 197-826 | ISARISMLEETLKNAKGAPGLQLEISAAHAMLDHLKSLEKKGTHLSQVTLKNRDGKSMQSLLKARVQQQRLSQIWDKPDANGKRAVN… |
| A0A3M3N348 | 1-505 | MPPALQPAESVEEVLDQDLSAAIKLLKTRHLSEKSDIVTFFKPFILESRLRDRLRLGGGGTLGVGLPSLPYSLISPIVSPIFSAEKS… |
| A0A2Z6EVE6 | 333-929 | None |
| A0A4V1PQY8 | 1-661 | None |
| A0A0F5K0D0 | 2-573 | None |
| A0A0F5K036 | 396-948 | None |
| A0A522M9G8 | 380-1056 | None |
| A0A1A9HL42 | 517-1103 | None |
| A0A4S0IQ52 | 472-1099 | None |
| A0A5C7A6Q1 | 562-1182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.