DPCstruct | MC30052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 403 ± 31 aa |
| Standard deviation of domain lengths | 30.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1VK63 | 61-477 | MVPTPVLDNQNYKGISTDRYGHTNSGKDVAPIRELYGPTDRYHATDWRMGAVARIYGNPYKDDSVFFMVTDMISDFGVSAFTHETTH… |
| A0A1Q8EDR7 | 3-332 | KNLSGVGTFAHEMTHGNDRENARAVLGAPKRAGLGAEILTRSMFETGDVTVGNSARIKPIFLFNTTTPIPESDRRIQASESLNTKEK… |
| A0A1S8KNB2 | 642-1040 | None |
| R6KKQ7 | 421-822 | None |
| E0TKZ2 | 463-860 | None |
| A0A1Y4RMU6 | 467-839 | None |
| Q59986 | 1450-1851 | None |
| A0A3P1VGE7 | 668-1081 | None |
| K1AGW9 | 1-374 | None |
| A0A139RGU6 | 1-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.