DPCstruct | MC30050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 568 ± 109 aa |
| Standard deviation of domain lengths | 109.12 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6MDJ1 | 2-502 | RIPLLIILITVVLTFWVDQIRELFLLLTTTTHVWHQVGTLVMAGALGFAVWHTARTVYRFDIPSIPSLANPKAEVLRKWAPRYLGAA… |
| A0A2G4GIM1 | 1-567 | MLSFINKSLKRLAVILQVFWVFFPGILFLAIGYLFFTHFIQGKDILITGLRSRQTGLFFIIGLLFWALITWYTSRLIAYNNDRLFRI… |
| A0A3N7DA33 | 25-694 | None |
| A0A1Q7AQ24 | 206-989 | None |
| A0A2V9R1W6 | 14-415 | None |
| A0A2A6LPY2 | 7-442 | None |
| A0A540X405 | 49-614 | None |
| A0A523HQ37 | 1-482 | None |
| A0A2U0TXP8 | 11-571 | None |
| A0A2Z6CL04 | 16-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.