DPCstruct | MC3005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 67 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5G0T8 | 1-75 | MASGFGYTGGPSRCFPFWQEFAKCYAQADFPNQCKAQKEDYVECLHHTQEKARAKALRHELQTQQAHQAHVGKQE |
| A0A7S0SRJ3 | 1-68 | MASGFGAKGNEGRCYKLWKNFSGCMSTADDPSDCIYMRADYIECLHHRNEVINQNTVTMEAEKLGKAS |
| M9LZ91 | 38-114 | None |
| A0A453RRI8 | 1-51 | None |
| A0A7S2NCU7 | 27-100 | None |
| A0A7R9YA79 | 19-95 | None |
| A0A0C2YA96 | 1-78 | None |
| A0A1P8AX87 | 36-88 | None |
| A0A1D8NNZ0 | 2-69 | None |
| A0A7S0K4M1 | 19-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.