DPCstruct | MC30045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 4.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0NUX5 | 44-131 | YIKTVVDISQKICSAGANRHFENEVELLKQGSEQTDLWGGGIDLETLMVDNNSIINIRPQDKNFSNEIQDPTRRTMFEDLMKYFFQIL |
| A0A7C4R689 | 1-92 | MEPNLVKAVVDIEKETIAIDAALHIDLRDVLVENGSEYKNLWGINLYPDNSGDELVEFDSMINIRPPINRSRGVEDENIRVKILEIV… |
| A0A0G1TYX8 | 140-221 | None |
| A0A3B1BST6 | 26-113 | None |
| A0A399ZQQ5 | 7-97 | None |
| A0A554IC05 | 26-110 | None |
| A0A0G1AE42 | 61-142 | None |
| A0A252DB15 | 1-79 | None |
| A0A7V2ATD8 | 4-82 | None |
| A0A1F7GB21 | 11-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.