DPCstruct | MC30044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 190 ± 35 aa |
| Standard deviation of domain lengths | 35.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.61 |
| Pfam Score | 99.19 |
| Assigned Pfam label(s) | PF05019- CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G6X2P5 | 12-217 | GFSALQSLFDTDFDVRRLFTAEDALEAGEYGRLTVEALQKDPAANQLFAERWTLPELNLSTFLQLPEGSFGRVYAEMLVANGFDPDY… |
| A0A3B8JTI8 | 20-153 | INPEREFNIDLEALRQLPEGTLGREVARFLDENSFDPFNSGDWIQRTHDVWHVLTGLSPSEHDELILQAFTRAQVFRPSCAILAIAG… |
| A0A654M2T3 | 19-198 | None |
| A0A4Q3B0L0 | 20-168 | None |
| A0A074N1H8 | 66-291 | None |
| A0A7J0G2K9 | 182-327 | None |
| M9MJ43 | 10-223 | None |
| D7P6A1 | 33-218 | None |
| A0A6V7U5F4 | 150-364 | None |
| D3AWR4 | 66-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.