DPCstruct | MC3004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061QH73 | 3-108 | YLEYIGLLNQVMMIATQLHNDALDPRNHKYSAHQIALLYQTLNMLRGQTKKLRKRIEDRFQEIKAITESSASPYLGAELQHWLQQIT… |
| A0A7S0SJ86 | 6-124 | DYFTHVSHLHQLLRMATQLHADASNVHNHKYLAHQIALLYQCVNQVRGESKPFKKRIEEQFDAVKHETEAPGPGAPAAALPPHLRAW… |
| A0A7S3GKG9 | 151-279 | None |
| A0A507E416 | 47-180 | None |
| A0A1Y2GAK5 | 33-157 | None |
| A0A1Y1Y1H9 | 3-110 | None |
| A0A2P6N160 | 269-377 | None |
| A0A168GGB4 | 505-625 | None |
| A0A1S3JH66 | 39-160 | None |
| D8U2G2 | 130-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.