DPCstruct | MC30038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Standard deviation of domain lengths | 11.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4HXA4 | 1-116 | MEKNPSPLIAQYQPKKNGRKSQSKPKNLFDRFIDYKNDILRFMHDFKVPQCMCGLCPTYIECREETAFCLSTTGKSKCIKEEKGCLC… |
| A0A842LBH2 | 13-93 | SMDRIEMQEEVKRLSDDCACPSCPSYRKCDERLFCILGESECIKDEKGCLCPTCLVASTLGIGISRNFYCTRGSEMDQRTK |
| A0A849Q8J5 | 1-83 | None |
| A0A5E4K1G8 | 1-64 | None |
| A0A5E4JT18 | 9-83 | None |
| A0A3A4P921 | 30-102 | None |
| A0A7T9CEB4 | 100-187 | None |
| A0A357BUF8 | 48-129 | None |
| A0A1V4ZRS4 | 10-98 | None |
| A0A7C1DTC1 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.