DPCstruct | MC3003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Standard deviation of domain lengths | 22.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9ISN9 | 2-128 | TDACAELGIGGLQGEDMVAVENTDDVHNVIVCTLCSCYPWPVLGLPPNWYKQPAYRSRIVREPRTMLRDEFGHDVPESVEVRVWDSS… |
| A0A7S0SJ16 | 9-161 | AAGEGARLVARAWVDPGFKARLLLDATAAAAELGIAAANNTAPTVLTVVENTPSAHNLIVCTLCSCYPRAILGMSPDWYKSRSYRAR… |
| A0A7S2S017 | 6-136 | None |
| A0A852W5S5 | 15-194 | None |
| A0A813GZP9 | 422-607 | None |
| A0A7S1LU64 | 53-184 | None |
| A0A6M6JF60 | 19-164 | None |
| A0A7S0DJ60 | 37-221 | None |
| A0A2D5E5G7 | 17-180 | None |
| A0A128EET2 | 21-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.