DPCstruct | MC30029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 326 ± 55 aa |
| Standard deviation of domain lengths | 55.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 89.97 |
| Assigned Pfam label(s) | PF13567- PF03772- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8EQN4 | 23-332 | VDLLRKKLLLHIESYPIDKVGEFTGALLFGNSNQLEETTRLNFSKLGLIHLLSISGVHVQYLVTVFRRLFRRFKLSKELTDEALLLM… |
| A0A2E2WVH3 | 227-615 | NKKPIRISDKISINAFFYNSTNKIFPGDFDYKIYNKSQKISGFGIASSIPLIKSNDNINFFSKIRIIISSKIDNSLINNQNAITKAL… |
| A0A0B8NQE7 | 82-426 | None |
| A0A3D4PFP2 | 4-293 | None |
| A0A2H5EUA4 | 572-996 | None |
| A0A3D2KSS9 | 192-539 | None |
| A0A3B9XI90 | 24-296 | None |
| A0A848C6H9 | 111-437 | None |
| A0A2E6GUV9 | 93-423 | None |
| A0A852RJP6 | 7-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.