DPCstruct | MC30028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 894 |
|---|---|
| Mean domain length (aa) | 293 ± 67 aa |
| Standard deviation of domain lengths | 67.34 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 97.00 |
| Assigned Pfam label(s) | CL0323- CL0012- PF07059- PF01151- PF12536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3DFJ4 | 7-197 | EIPEKHVPFDFETYFNSQERFLVGTTDCETGQSVYFEKEGTNDDALNLLQASSSLPFIAPVVNYRGKQLLDGGISDPIPVRKAQEDG… |
| A0A2E0EN92 | 3-302 | YENLVFEGGGVKGVAYARIPKLLDEKGILKNIRRVAGSSAGSIAALLIALEYDPCTIAEIIKNMQFQYFQDSYTISYQIFRLITHYG… |
| A0A0F9U4A6 | 41-326 | None |
| A0A199W0Y5 | 47-267 | None |
| A0A1B8EUG2 | 1-190 | None |
| A0A2B4S0K7 | 2-317 | None |
| A0A2B4SKV6 | 8-255 | None |
| A0A525VX38 | 103-403 | None |
| A0A4S9MGS3 | 519-843 | None |
| A0A4U0XS32 | 465-811 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.