DPCstruct | MC30023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 500 |
|---|---|
| Mean domain length (aa) | 156 ± 26 aa |
| Standard deviation of domain lengths | 26.03 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.83 |
| Pfam Score | 85.40 |
| Assigned Pfam label(s) | PF07452- PF00080- PF07589- PF10099- PF19422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q19AV7 | 3-151 | RAVAVLRGDSLVKGTVTFEQADEKSPTTISWNISGHDANAQRGFHIHQFGDNTNGCTSAGPHYNPFSKNHGAPSDVDRHVGDLGNIT… |
| A0A3D0QIY7 | 17-174 | AAAQHDMHKMEKGPIKAVAVVFPAKDKTVKGLITFTQTEEGVKVVAHLEGLAPGTHGFHVHEFGDCSAPDFMSAGGHFNPTQMAHGA… |
| A0A0C2JY29 | 104-261 | None |
| A0A7S4SE32 | 24-162 | None |
| A0A7S2MRD9 | 200-371 | None |
| A0A061RLM2 | 44-186 | None |
| A0A7Y1ZWE2 | 216-363 | None |
| A0A7R9L057 | 83-216 | None |
| A0A7Y3B6S0 | 129-290 | None |
| A0A7S0MIV4 | 13-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.