DPCstruct | MC30020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 106 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.83 |
| Pfam Score | 89.70 |
| Assigned Pfam label(s) | PF09404- PF18755- PF16135- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5CCS9 | 2-65 | NTRGQVAKVRADGTLIAGEAKGSIHQVGAALEHAPSCNGWTYWNFKRDGKMVSIDVLRQQIRAE |
| A0A3D0QBR1 | 17-109 | KWTQKINTGTLKKRKPGLAGLLPANAQLQAIYKGKEYSATVDEQGRIELDGTLFNSPSAAATHVTKGPKDGWILWRYQDEGGTWLSI… |
| A0A3Q2U5U7 | 232-358 | None |
| A0A2G8TDY2 | 121-218 | None |
| A0A4S8QJ32 | 39-143 | None |
| W5W3E5 | 23-96 | None |
| A0A847KFK3 | 123-216 | None |
| A0A495A5V9 | 2-90 | None |
| A0A1J4RIL1 | 182-298 | None |
| A0A1Q9SPC2 | 18-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.