DPCstruct | MC30019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 6.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R4KIU3 | 1-110 | MTGDQLEMLPVSAKNVAGLYIRWNEQTGTGDGLVLGFDFNKANELADTSNMTGPFVKIKTALSMMDYVDRPETMVSTIKKFKINSAS… |
| A0A662JQF7 | 136-258 | VYDSTVGKRRMRVMMLSKEQSEQLPPVAGIYVRWDRSEDRGDAVVLTFDWDKACSVCGVERSWFKKFDSYEWWYARLKVDLDLLDYL… |
| A0A7C3VWG2 | 257-365 | None |
| A0A2T5G5T7 | 53-167 | None |
| A0A849PLM5 | 54-170 | None |
| A0A8B6QKR5 | 385-497 | None |
| A0A7V2V972 | 14-133 | None |
| A0A520K6P1 | 249-348 | None |
| A0A7J9RQS2 | 1-109 | None |
| A0A3R7F4C4 | 187-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.