DPCstruct | MC30013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 246 ± 24 aa |
| Standard deviation of domain lengths | 24.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4QXR9 | 17-261 | LSGSPRERRLSPEERRRVTRAAFLHPMGLFVVVIGGVFSALSLSWWAVVLTLVTYTALVFLAARDPLFWAHVLEGREYRLEARTSPS… |
| A0A2T6DM51 | 21-304 | IRRPTITMLRYITAAFFARPQLPGLGRVPLNLLGLATAGALGYFVHPSFYAIGGGLEVMYLYALATNPRFQAITDAIANEKTRPLPP… |
| A0A534UXK4 | 121-343 | None |
| A0A7V9L644 | 1-284 | None |
| A0A0S8BIE0 | 16-297 | None |
| A0A6L5EXD2 | 4-235 | None |
| I1D435 | 46-302 | None |
| A0A6J4HSP6 | 11-262 | None |
| A0A7C1K6F9 | 9-271 | None |
| A0A7J9Y603 | 2-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.