DPCstruct | MC30005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 143 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2QZC5 | 197-346 | MNIEREQVKENKQNRKHLKSTARIKAEKERIRVEEERKLENVRQLAEARQKLEERELLILERLKLEEEEERAVQLQRRKREEKGKVS… |
| A0A1A8MWF0 | 1-127 | MKAEKEKLRLEEERRLERIQQLSEVKRKLEERELLIQARLKLEEEEEERAVQRQRSKIKEEEKDTRRYVEALRAQMKERLSLLKLEL… |
| A0A6F9D920 | 389-543 | None |
| Q0P6D6 | 782-936 | None |
| A0A3M0ITB6 | 1-155 | None |
| H0XYU1 | 43-174 | None |
| A0A3S1B535 | 318-453 | None |
| A0A4Z2AWH8 | 281-416 | None |
| H2Y652 | 2-146 | None |
| A0A667X029 | 336-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.