DPCstruct | MC30002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 177 |
|---|---|
| Mean domain length (aa) | 103 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9R0Q8 | 2-119 | EGGGCLIATAAYGSEMAPQVQFLREIRDNKVMSTESGASFMSGFNEFYYSFSPAIADYERENPVFKEVVKLGITPLVSSLAILDYAN… |
| A0A7T4UNL4 | 735-852 | TGGDQASNSGGSGGGGGGGACFIATAAYGSYLAPDVKVLRDFRDHVLLPYDFGQKLVAMYYHYSPPIADKIAASPALRSVTRAGLSP… |
| A0A7T5RJZ6 | 191-305 | None |
| A0A1W9M5Q0 | 209-315 | None |
| A0A0S7ZLK7 | 426-534 | None |
| A0A7X6DRC8 | 467-558 | None |
| A0A7C2ETU1 | 583-698 | None |
| A0A832UGZ0 | 195-322 | None |
| A0A3B9XGI6 | 206-285 | None |
| A0A1Y4V5B3 | 277-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.