DPCstruct | MC3000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 132 ± 24 aa |
| Standard deviation of domain lengths | 24.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7DWZ2 | 19-129 | SEIAGLSATKTKKALKDRDLDTEGTPAELTARLTAAIASRKLDATPIAMDVDEDFDATQGGTTMAATGRDDPDSLEAISKLSVNELK… |
| A0A7S0S9A7 | 12-155 | EEEEADALPNVAALKRLTVVSLRELLSTRGLPTGGKKEELIQRLDECRGAAAEEESDDEEEEEERESDDKEEEEDSKDAVPDVGALK… |
| A0A7S1RLD5 | 7-126 | None |
| A0A0D9Y862 | 4-145 | None |
| A0A0V0I5D9 | 2-122 | None |
| A0A7S2LXB4 | 76-228 | None |
| A0A7S1YYE1 | 49-196 | None |
| A0A7R9U620 | 28-234 | None |
| A8JDV3 | 47-174 | None |
| A0A7S2T0R1 | 150-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.