DPCstruct | MC300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 229 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U9NS13 | 11-228 | PPVPPARRLAAAPGGLAEAVELTAAHLDSRAHTVADFERSLDGLVRHAHRDRHPLARALSRALGHRYKEQEIEAHRLGGVDAVVASL… |
| A0A6N9XXT2 | 16-246 | DDLPPPLPEAAAPPPIAGVDELVEEIAASLGRRWPALTTERVMDGLVRLGTADRERLAAALLPVVRREQVGAYDHPWAVFNQSVQMH… |
| A0A4V2YRU1 | 386-606 | None |
| A0A3N4S9Y8 | 28-231 | None |
| A0A3N6EWQ7 | 300-531 | None |
| A0A7Y6I2E4 | 172-419 | None |
| A0A1Q9TM27 | 2-224 | None |
| A0A850DI60 | 159-393 | None |
| W7VRK3 | 46-281 | None |
| A0A2T0R4M7 | 407-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.